Protein Info for Atu3459 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 9 to 32 (24 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 140 to 165 (26 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details amino acids 309 to 332 (24 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 17 to 107 (91 residues), 39.6 bits, see alignment E=5.4e-14 PF00528: BPD_transp_1" amino acids 119 to 340 (222 residues), 138.9 bits, see alignment E=1.7e-44

Best Hits

Swiss-Prot: 44% identical to DPPB_HAEIN: Dipeptide transport system permease protein DppB (dppB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu3459)

MetaCyc: 40% identical to dipeptide ABC transporter membrane subunit DppB (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CSI6 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Atu3459 ABC transporter permease (Agrobacterium fabrum C58)
MSKRRLSLYGLSGQIGSIAVTLLGLLLLTFFIGRLMPADPVRAIVGEDATRETYEQVYHA
LGFDRPLWQQFIYYLGDVFTGDFGTSIRTGRPVIEDIIRVMPATMELATFAILIGAGLGI
PMGVYAAVNKDRWQDHLVRVLSLFGHSMPIFWTGMIALIVFYAHLGLVGGGGRMDQFYIG
LVEERTGFLLIDSLLAGDMEVFWSAINHLILPAALLGYSSSAYITRMTRSFMLDQLGQEY
VTTARVKGLSQRQTVWLHAFGNIRVQLVTIIALAYGSLLEGAVLIETVFAWPGFGQYLTS
NLIIGDMNAVMTCVLIVGVIFIGLNLLSDILYRFFDPRTR