Protein Info for Atu3436 in Agrobacterium fabrum C58

Annotation: oligopeptide ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF00005: ABC_tran" amino acids 21 to 178 (158 residues), 108.2 bits, see alignment E=5.2e-35 PF08352: oligo_HPY" amino acids 229 to 296 (68 residues), 49.2 bits, see alignment E=5.7e-17 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 229 to 314 (86 residues), 56.4 bits, see alignment E=1.3e-19

Best Hits

Swiss-Prot: 48% identical to OPPD_BACSU: Oligopeptide transport ATP-binding protein OppD (oppD) from Bacillus subtilis (strain 168)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to atu:Atu3436)

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppD (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CF74 at UniProt or InterPro

Protein Sequence (332 amino acids)

>Atu3436 oligopeptide ABC transporter ATPase (Agrobacterium fabrum C58)
MSKLIEVHDLSVSFGSAQPVKGVSFDVSPGEMLAIVGESGSGKSLTALGLIGLLPSHAKT
GGRVQLEGRDLLPLSERQWRGIRGRDIGMIFQEPMTSLNPVLTVGEQIIEVLRIHEKIDR
RQARKRAIELLDLVNIPDAARRVDDYPHQLSGGMRQRVMIAIGVACNPKLLIADEATTAL
DVTIQAQILQLLDNLRRDLNMAVILITHDLGIVAQWADRVMVMYAGRKVEEGLPEPVFSN
PYHPYTRGLLAASPRAEDGQHYRDGPLIEIPGSIVSATGERGCAFRPRCPSARGFCGQFV
PPLRPISEGRYAACPFVFPTSQEISDDALVSA