Protein Info for Atu3434 in Agrobacterium fabrum C58

Annotation: oligopeptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 107 to 132 (26 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 249 to 275 (27 residues), see Phobius details amino acids 295 to 318 (24 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 15 to 80 (66 residues), 24.4 bits, see alignment E=2.8e-09 PF00528: BPD_transp_1" amino acids 121 to 325 (205 residues), 150 bits, see alignment E=6.6e-48

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu3434)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CSG4 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Atu3434 oligopeptide ABC transporter permease (Agrobacterium fabrum C58)
MSNSKRILSQARRVAIQAVPTVLGIVILNFFLLQLAPGDAADVLAAEAGSATVETMAEMR
SRFGLDLPIVHQLMNYLGNLAQFSLGFSPRYGMPVADLIGQRLPGTLALMGAALGIAIFV
GVFLGSIMALFSGKLPDRIISIGSLIFYSVPGFWIGLMLILTFSVKLGWLPSGGDSTIGS
SLTGFAAFLDRLRYIVLPALSLALYFLAIYARLTRAAMLEVKSQDYVRTARAKGVSPFRL
ITRHILRNALIPITTMAGMHIGGLLGGAVVVETVFSWPGLGRLAFEAVMARDFSVLLGIL
LLSSLVVIIVNAAVDLLQAWLDPRIGESR