Protein Info for Atu3421 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 TIGR03558: luciferase family oxidoreductase, group 1" amino acids 4 to 326 (323 residues), 328.3 bits, see alignment E=2.6e-102 PF00296: Bac_luciferase" amino acids 18 to 293 (276 residues), 100 bits, see alignment E=8.6e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3421)

Predicted SEED Role

"Luciferase-like monooxygenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CSF4 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Atu3421 hypothetical protein (Agrobacterium fabrum C58)
MYTLSLLDKSPVPTGEDAVSAFRDTINLAKRAEELGYRRFWVAEHHNSPELAGSAPEALV
AWILAKTSRIRVGSGGVMLQHYSPYKVAEVFNVLSSLAPGRVDLGVGKTPGGLPLATSAL
QQAYDLARKPDFETAFGELTTFLAGSAPQDQAQAGLQATPVPPIAAERFLLGASPESARL
AASKGWNFVFAGHLNGDPEVLRRSLLAFRETSGGSAPILALSAFAASDPAHAARQVEGQR
IYRVFLSDGRAFNLGRREQAEEFARQSGDSDYRIEERKPNVLHGGPDDIHRALRALSEEH
GIEEFIIEPPHVGADQRLASIELLATHRLSRAA