Protein Info for Atu3417 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 603 transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 84 to 108 (25 residues), see Phobius details amino acids 115 to 139 (25 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 247 to 263 (17 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 79 to 193 (115 residues), 47.9 bits, see alignment E=8e-17 PF00528: BPD_transp_1" amino acids 98 to 299 (202 residues), 72.5 bits, see alignment E=7.5e-24 PF00005: ABC_tran" amino acids 370 to 528 (159 residues), 121 bits, see alignment E=1.2e-38 PF13304: AAA_21" amino acids 496 to 558 (63 residues), 39 bits, see alignment E=2.1e-13

Best Hits

KEGG orthology group: K02028, polar amino acid transport system ATP-binding protein [EC: 3.6.3.21] K02029, polar amino acid transport system permease protein (inferred from 100% identity to atu:Atu3417)

Predicted SEED Role

"Amino acid ABC transporter permease protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.21

Use Curated BLAST to search for 3.6.3.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CF66 at UniProt or InterPro

Protein Sequence (603 amino acids)

>Atu3417 ABC transporter permease (Agrobacterium fabrum C58)
MTIASDFPHVALNEPKAAPVESGLAKSGYSHFRIVPARYPLRTVGTVFSVLVIAAVLHSV
FGNPRWGWDVFAEWFFAEPVLVGLGRTLLLTALGALFGFVLGTLLALARVSRSPLLVAVS
WTYIWIFRSIPLIVLLLILNNLGYLYETVTIGVPYTGINFISWNTTQLMTPFAAAILGLT
LNQAAFASEIVRGGILSVDQGQLEAAAALGLPRRRQASRIILPQAMRSILPTAFNDIIGL
AKGTSQVYILALPELFYTIQIIYRRNLEVIPLLMVATVWYLVILTALSIVQHHIERHFSR
GALRNPPPSLFATIFRTFLPRKSTPGAVETVTAKSERKAPARAASFQLGNRGGSVNIHGV
SKSFGSLKVLDDISLSIPAGSVTTILGQSGSGKSTLLRSINHLERVDDGFIAIDGELVGY
RQKGDTLYELKEREILKRRAEVGMVFQSFNLFPHLTALENIIEAPVAVRGISKEQAEVEA
RDLLARVGLADKAAAYPRQLSGGQQQRVAIARALALRPKVLLFDEPTSALDPELVNEVLD
VIKELSRSGVTLIIVTHEIGFAREVSDRVVFMEQGRILETGTPDKVFNSPDHPRTAEFLA
KVL