Protein Info for Atu3410 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 137 to 162 (26 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 239 to 265 (27 residues), see Phobius details amino acids 285 to 309 (25 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 6 to 104 (99 residues), 43.3 bits, see alignment E=3.7e-15 PF00528: BPD_transp_1" amino acids 118 to 316 (199 residues), 109.1 bits, see alignment E=2.3e-35

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu3410)

Predicted SEED Role

"Peptide ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CF61 at UniProt or InterPro

Protein Sequence (316 amino acids)

>Atu3410 ABC transporter permease (Agrobacterium fabrum C58)
MNSRILSLIARRLVVMLTTLLIVSFIVFSATSLLPGDTATILLGQSATPEAVAGLRTAMH
LDDPALLRFVRWLFGLLHGELGTSYANNMAIADLIGPRFINSMKLAGITTVIAVPLALTL
GISSAMLRGTLYDRAVTVLTIGVISVPEFMIATLAVLLFAVYLKWLPALSLVSEIHSVFD
VLRIYAMPVITLTFVVSAQMIRMSRAAVIETLDTPYVEMALLKGAPRMRIVLRHALPNAL
GPIVNAVALSLSYLVGGVIIVETIFNYPGIAKLMVDGVATRDLPLIQSCAMIFCVGYLLL
ITTADIIAIMSNPRLR