Protein Info for Atu3408 in Agrobacterium fabrum C58

Annotation: 2-haloalkanoic acid dehalogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 TIGR01493: HAD hydrolase, family IA, variant 2" amino acids 54 to 232 (179 residues), 107.6 bits, see alignment E=7.9e-35

Best Hits

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to atu:Atu3408)

Predicted SEED Role

"2-haloalkanoic acid dehalogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CF59 at UniProt or InterPro

Protein Sequence (281 amino acids)

>Atu3408 2-haloalkanoic acid dehalogenase (Agrobacterium fabrum C58)
MQTALNAIKKGVVTSGNGTRIPSGNRIICRRLPQEAKAAKRRPTLPKNLSDFKYMSFDVV
GTLIDFEGGLKATLAEIGTEHGVEVDGEKALALYRAARYSDATDLFPDDLVRVYLIIAPE
LGLPGERALGERLRDAAKSWKGFADSRAAMAELAKTHRLIAMTNAQRWAFEYFSKELGNP
FHAAFTADDTGTEKPDPAFFEKVFAFVESEGASKDDILHVAQSQYHDIGISRQLGMTNCW
IERRHTQKGYGGTIEPENFTEPDFHFTSMADLAAAVRQTGG