Protein Info for Atu3405 in Agrobacterium fabrum C58

Annotation: haloalkanoic acid dehalogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF00702: Hydrolase" amino acids 7 to 187 (181 residues), 39.1 bits, see alignment E=1.1e-13 TIGR01428: haloacid dehalogenase, type II" amino acids 7 to 200 (194 residues), 204 bits, see alignment E=3.7e-64 TIGR01493: HAD hydrolase, family IA, variant 2" amino acids 8 to 183 (176 residues), 53.1 bits, see alignment E=6.6e-18 PF13419: HAD_2" amino acids 99 to 189 (91 residues), 29.3 bits, see alignment E=8.2e-11

Best Hits

KEGG orthology group: K01560, 2-haloacid dehalogenase [EC: 3.8.1.2] (inferred from 100% identity to atu:Atu3405)

Predicted SEED Role

"Haloacid dehalogenase, type II"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.8.1.2

Use Curated BLAST to search for 3.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CSD8 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Atu3405 haloalkanoic acid dehalogenase (Agrobacterium fabrum C58)
MTIFRPKYITFDCHGTLIHFQMAEAARDLYGDRLGEAEMEEFIKNFSAYRLDEVMHDWKP
YADVVHNALSRTCKRNGVAFKDEDAAMVYERVPTWGPHADVPAGLSKVAKEIPLVILSNA
MNAQIMSNVAKLGAPFHAVYTAEQAQAYKPHFKAFEYLFDMLGCGPEEILHVSSSFRYDL
MSAHDLGIKNKVWVNRGHEPANPYYGYTEISDISGLAGVVGL