Protein Info for Atu3370 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 89 to 105 (17 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 181 to 205 (25 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 315 to 334 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 61 to 328 (268 residues), 153.4 bits, see alignment E=3.4e-49

Best Hits

Swiss-Prot: 38% identical to MGLC_ECOLI: Galactoside transport system permease protein MglC (mglC) from Escherichia coli (strain K12)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to atu:Atu3370)

MetaCyc: 38% identical to D-galactose/methyl-galactoside ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-18-RXN; TRANS-RXN0-541

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CF35 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Atu3370 sugar ABC transporter permease (Agrobacterium fabrum C58)
MTTNAANAQLDAKSGRKPHRRIPPEANIFFVLIGIALVYEILGWIFIGQSFLLNQQRLTI
MILQVSVIGIIAVGVTQVIITGGIDLSSGSVVGLTAMLAASVGQSSTWPRALYPGLTDLP
FFIPLAVGILAGALAGFINGQLIARTKIPPFIATLGMMVTARGLSKWYTKGQPISGLTDG
FTFIGTGVWPVVVFLVVAIIFHVALRYTRYGKFTYAIGANQQAARVSGINIEAHLIKVYA
IAGLLAGLAGVVTAARAQTAQAGMGVMYELDAIAAAVIGGTSLAGGAGRITGTVIGTIIL
GVMTSGFTFLRVDAYYQEIVKGLIIVAAVVADVYRQKKRAKR