Protein Info for Atu3367 in Agrobacterium fabrum C58

Annotation: TRAP dicarboxylate transporter subunit DctM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 transmembrane" amino acids 12 to 42 (31 residues), see Phobius details amino acids 54 to 80 (27 residues), see Phobius details amino acids 104 to 134 (31 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details amino acids 226 to 252 (27 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 330 to 360 (31 residues), see Phobius details amino acids 369 to 393 (25 residues), see Phobius details amino acids 411 to 432 (22 residues), see Phobius details PF06808: DctM" amino acids 13 to 434 (422 residues), 312.3 bits, see alignment E=2.5e-97 TIGR00786: TRAP transporter, DctM subunit" amino acids 22 to 438 (417 residues), 329.8 bits, see alignment E=1.1e-102

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3367)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctM subunit, unknown substrate 6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CF32 at UniProt or InterPro

Protein Sequence (489 amino acids)

>Atu3367 TRAP dicarboxylate transporter subunit DctM (Agrobacterium fabrum C58)
MFEYGILPPLMFLGMIIFMLYGFPVAFSLATVGLVFGVIGIFTEHFSPAFLQALPLRIFG
IISNDLLLAIPFFTFMGAILERCGLAEDLLEGTGKLFGAIPGGLAYAVIIVGAILGAITG
TVAASVITMGVISLPIMLKYGYNPRLATGVIAASGTITQVIPPSLVLIVLADQLGKSVGD
MYLGAIGPSILQVTIFMLFILLMSIVRPKDLPALPPEARGELNRALVFRVLAGMIPSIVL
IFLVLGTIFLGLATPTEAGALGVVGAMVLAAAHRRLSWDLVKQGMHSTMHITSMVVFILV
GATCFSLVFQGMDGSLWIEHMLSGIPGGPIGFLIFVNIFIFFLAFFLDFFEIAFIVIPML
APIAQSLGIDLIWFGVLICINMQTSFMHPPFGFALFYLRSIAPRSVKTSDIYMGAIPWLG
MQLILVAIVIFWPESVTYWLDKAPDVDLNSIKIEIPAFGNQGGNTMPNFGQPGGLPGMPN
LGEPPKVGP