Protein Info for Atu3362 in Agrobacterium fabrum C58

Annotation: monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR03860: FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family" amino acids 12 to 426 (415 residues), 573.9 bits, see alignment E=9.4e-177 PF00296: Bac_luciferase" amino acids 27 to 382 (356 residues), 170.2 bits, see alignment E=3.7e-54

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3362)

Predicted SEED Role

"Nitrilotriacetate monooxygenase component A (EC 1.14.13.-)" (EC 1.14.13.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CF28 at UniProt or InterPro

Protein Sequence (436 amino acids)

>Atu3362 monooxygenase (Agrobacterium fabrum C58)
MTNTTRKRQMHLGLFLQGAGHHVSGWRHPDAEAGSENFDLLTRVTKMAEAAKFDMVFLAD
GLTSGVDAHPSMIARFEPLTLLAALAMVTDKIGLAATASTTYGEPYHTARAFASIDHLSH
GRAAWNIVTTSYARTAANFSKSHPEHDERYAVAEEYVNVVRGLWDSWDDDAFVKDKQAGR
YVDPEKVHILDHEGKYFTVKGPLNIPRSPQGHPVLIQAGSSGPGQDLAARTADIVFTAQQ
AISEAQAFYTSLKARVAKFGRDPASVAVMPGFMPIIGRSFEEAGEKLKELNRWTDIKNAM
PLLEERIGHSLADYDLDGPLPDLPISDQLRSRAELLTELARREKLTIRELALRVAAGRGH
HIVMGTAKEVADRMQQWFENGAADGFNVMPPFFPGGLEEFNREVVPLLQERGLFRKDYEG
STLRDHLGIARPAVRA