Protein Info for Atu3353 in Agrobacterium fabrum C58

Annotation: mannose-1-phosphate guanylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01479: mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase" amino acids 8 to 475 (468 residues), 695.4 bits, see alignment E=1.9e-213 PF00483: NTP_transferase" amino acids 10 to 290 (281 residues), 152.8 bits, see alignment E=3.1e-48 PF22640: ManC_GMP_beta-helix" amino acids 300 to 352 (53 residues), 50 bits, see alignment 5.6e-17 PF01050: MannoseP_isomer" amino acids 360 to 471 (112 residues), 160.5 bits, see alignment E=4.2e-51 PF07883: Cupin_2" amino acids 387 to 455 (69 residues), 50.4 bits, see alignment E=3.8e-17

Best Hits

Swiss-Prot: 46% identical to MANC_SALTY: Mannose-1-phosphate guanylyltransferase ManC (manC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00971, mannose-1-phosphate guanylyltransferase [EC: 2.7.7.22] (inferred from 100% identity to atu:Atu3353)

MetaCyc: 47% identical to phosphomannose isomerase / GDP-D-mannose pyrophosphorylase (Pseudomonas aeruginosa)
Mannose-6-phosphate isomerase. [EC: 5.3.1.8]; Mannose-1-phosphate guanylyltransferase. [EC: 5.3.1.8, 2.7.7.13]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.8

Use Curated BLAST to search for 2.7.7.13 or 2.7.7.22 or 5.3.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CF23 at UniProt or InterPro

Protein Sequence (476 amino acids)

>Atu3353 mannose-1-phosphate guanylyltransferase (Agrobacterium fabrum C58)
MNEQSRKITPVLLAGGAGSRLWPVSRDQLPKQFQPLVGNLSTYQQTLKRVGDKSLYSEPL
VITNEDFRFFARRQAEEIDLPATVVLEPARRDSAAAMAAAAVLAERREPGCLVLALAADH
VVLDVDKFSEAVKLGAKAADQGNIVVFGLVPTEPRTSYGYIKPGDAIDGEKDLSTVDAFV
EKPDVTTAISYLEKGYLWNSGNFLFRSDVMIAELKAFAPEILAAVTQAVEQYESDLGFVR
LHQASFEASPKNSIDYAVIEKTKRMAVVHGHFRWSDIGSWDAIWEIADKHDNDNALEGDG
VFIDSEGCLIHSTQLLTTVVGAKDLVVVATKDAVLVVPKNRVQDVKGLVDTLKGGDHAPQ
TQTHKRVYRPWGYIEHMYVDQRYRVGHITVDPGHRISFQKHYHRSEHWIVVKGTATVTIG
EETRLLTENQSVYIPIGQPHRLANEGQIPLELVEIQTGAYLGEDDVIRIEDDYKRQ