Protein Info for Atu3351 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 162 to 187 (26 residues), see Phobius details amino acids 208 to 232 (25 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 91 to 285 (195 residues), 48.3 bits, see alignment E=5e-17

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu3351)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CF21 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Atu3351 sugar ABC transporter permease (Agrobacterium fabrum C58)
MASQTRSRRPNQLFRNLNSKIASIPMILTAMVIFLGGTVWTVIYSFTNSKLLPRASFIGF
DQYERLWAAPRWIVSIQNLAIYGILSLIFSLVIGFVLAALMDQKIRFENTFRTIFLYPFA
LSFIVTGLVWQWLLNPEFGIQSVVRSMGWESFTFDPLYNPQIVIYGILIAALWQGTGLVM
CLMLAGLRGIDEDIWKATRVDGIPMWKTYILIIIPMMRPVFITTLVIIASGIVKVYDLVV
AQTSGGPGIASEVPAKYVYDYMFQAQNLGQGFAASTMMLLTVAIIVIPWAYLEFGGKKRG