Protein Info for Atu3325 in Agrobacterium fabrum C58

Annotation: exopolysaccharide production protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 15 to 32 (18 residues), see Phobius details amino acids 36 to 53 (18 residues), see Phobius details amino acids 65 to 81 (17 residues), see Phobius details amino acids 93 to 110 (18 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 232 to 258 (27 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 360 to 376 (17 residues), see Phobius details amino acids 382 to 400 (19 residues), see Phobius details PF04932: Wzy_C" amino acids 189 to 336 (148 residues), 63.3 bits, see alignment E=1.2e-21

Best Hits

Swiss-Prot: 62% identical to EXOQ_RHIME: Exopolysaccharide production protein ExoQ (exoQ) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to atu:Atu3325)

MetaCyc: 62% identical to O-antigen ligase family protein (Sinorhizobium meliloti 1021)
RXN-22295 [EC: 2.4.99.26]

Predicted SEED Role

"Exopolysaccharide production protein ExoQ"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.99.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CF04 at UniProt or InterPro

Protein Sequence (422 amino acids)

>Atu3325 exopolysaccharide production protein (Agrobacterium fabrum C58)
MRIAKSALIDPQRNEVYGMAAIALSFFVFAYSSRFGMVSVLAYYGLWLPLVVVDYRRVLG
NYPRYLWIFGFGILTVLSSFWSEAASVTMRASIQYMTHIVCALIAMRVISIRTLTRGALI
GTTLVLLYSLLFGIYLFDALDGTYSFVGAFSSKNQLGFYASLGVIFAASSVLVLKQRGIW
LPIAGVTGLLSAYSLVASQSATSAITTAAVVALIIGFIPIGMLSPANRKMTFFALGGLGA
LLVVASLQFGLLDAILGIFGKDSTLTGRTYLWQQGIEAAKQTPVFGVGYQGFWVVGFADA
ERLWNDFFIAGRSGFHFHNTYIETVVENGFVGMLLLAMVLYGTLLGHLRSVLMRKSDPQG
VILFSICALFVVRSFVEIDIIFPYQIGSFLLYFAAGKLCLPVKMAQDGETHPAIGMRLQT
RA