Protein Info for Atu3322 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 55 (19 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 237 to 239 (3 residues), see Phobius details TIGR01842: type I secretion system ATPase" amino acids 1 to 536 (536 residues), 790.7 bits, see alignment E=3.4e-242 PF00664: ABC_membrane" amino acids 2 to 255 (254 residues), 46.6 bits, see alignment E=3.8e-16 PF00005: ABC_tran" amino acids 326 to 474 (149 residues), 108.4 bits, see alignment E=4.7e-35

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to atu:Atu3322)

Predicted SEED Role

"STRUCTURAL ELEMENTS; Cell Exterior; surface polysaccharides/antigens"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CS58 at UniProt or InterPro

Protein Sequence (551 amino acids)

>Atu3322 ABC transporter permease (Agrobacterium fabrum C58)
MVVVMLFTVAINILLLAIPLYLFQISDRVLTSRSMDTLVMLTVAVLGAVLLQAFMDAIRR
FILMRTAVELEVQLGAPILSAAARASLHGSGKDYQTLQDLQQLRSFLTSGTLIAFLDAPL
MPLFIVVVYLVHPHLGIIIMVCCVVLFGIAWLNQRFTARQFSEASGYLSRANFHLDSMSR
NSQIINALAMIPEAVKMWGRETAGSLKSHVAAQDRNIMFSGVSKAARMVTQIALLGWGAH
LSLSGELTGGMVIAASIISGRALAPIEGAIEGWHQFNKSAASYGRIKQLLINSPLNFPRL
RLPNPEGRLDVERILFVPPPQKKVILNGISFSLKKGESLAIIGNSGSGKTTLGKMLVGSI
LPTSGNVRLDLMDLRNWDQRQFGESIGYLPQDVQLFPGTIKANICRMRDDVEDRQIYEAA
VLADVHELIAGFPQGYETVVAADGAPLSGGQKQRIALARAFFGDPKFVVLDEPNSNLDTA
GEQALARALLHAKKQGITTVTITQRPALLQCVDKIMVLKDGSVAMFGERMDVLKALSGNG
RPAAQSPQIEG