Protein Info for Atu3301 in Agrobacterium fabrum C58

Annotation: short-chain alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF01370: Epimerase" amino acids 1 to 65 (65 residues), 21.2 bits, see alignment E=2.6e-08 PF00106: adh_short" amino acids 2 to 189 (188 residues), 144 bits, see alignment E=6.2e-46 PF13561: adh_short_C2" amino acids 5 to 238 (234 residues), 187.4 bits, see alignment E=4.9e-59

Best Hits

Swiss-Prot: 58% identical to FIXR_BRADU: Protein FixR (fixR) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: None (inferred from 100% identity to atu:Atu3301)

Predicted SEED Role

"Probable short-chain dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEZ5 at UniProt or InterPro

Protein Sequence (239 amino acids)

>Atu3301 short-chain alcohol dehydrogenase (Agrobacterium fabrum C58)
MLLTGASRGIGHATVKLFQEKGWRILTVSRQPFSEECRWPSARESHIQADLEDLSRIDDL
ADEVRSRLPEGKLAALVNNAGISPKGEGGSRLGVVDTTADIWTRVMNVNLISTALLARAL
LPELEVAKGSIVNVTSIVGSRVHPFAGVAYAASKAALAALTRELAHEFGPRGVRANAIAP
GEINTAILSPGTAELVDAQVPLGRLGTTTEVAQTIYFLCSEQSSYINGAEIHINGGQHV