Protein Info for Atu3299 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details PF00892: EamA" amino acids 8 to 142 (135 residues), 89.5 bits, see alignment E=2.2e-29 PF05653: Mg_trans_NIPA" amino acids 75 to 141 (67 residues), 26.9 bits, see alignment E=2.7e-10

Best Hits

Swiss-Prot: 71% identical to YCB6_SINSX: Uncharacterized transporter in cobO 3'region from Sinorhizobium sp.

KEGG orthology group: K08978, putative membrane protein (inferred from 100% identity to atu:Atu3299)

Predicted SEED Role

"FIG00985168: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CS40 at UniProt or InterPro

Protein Sequence (145 amino acids)

>Atu3299 hypothetical protein (Agrobacterium fabrum C58)
MKNLFLAWQFWALLSAAFAALTAIFAKIGIENVNSDFATFIRTIVILAAAGLMVYVTGNW
QQPSTISGRTWLFLVLSGLATGASWICYFRALKIGDAARVAPIDKLSVVFVAVFAVLFLG
ERLSLPNWLGIVLIACGAVLVAYRG