Protein Info for Atu3298 in Agrobacterium fabrum C58

Annotation: C4-dicarboxylate transporter DctA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 153 to 178 (26 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 230 to 253 (24 residues), see Phobius details amino acids 318 to 349 (32 residues), see Phobius details amino acids 357 to 385 (29 residues), see Phobius details PF00375: SDF" amino acids 20 to 412 (393 residues), 380.4 bits, see alignment E=5.4e-118

Best Hits

Swiss-Prot: 100% identical to DCTA_AGRFC: C4-dicarboxylate transport protein (dctA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 100% identity to atu:Atu3298)

MetaCyc: 64% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"C4-dicarboxylate transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P58734 at UniProt or InterPro

Protein Sequence (448 amino acids)

>Atu3298 C4-dicarboxylate transporter DctA (Agrobacterium fabrum C58)
MIDSTAVAAGHAKQPFYKHLYFQVLVAIIAGIALGHFYPTFGEQLKPLGDGFIRLVKMII
APVIFLTVATGIAGMNDMKKVGRVAGKAMIYFLVFSTLALIVGLIVANTVQPGAGMNIDP
ATLDAKAVATYADKAHEQTITGFLMNIIPTTIVGAFASGDILQVLFFSVLFGIALGIVGE
KGKPVTDFMHAMMYPIFKLVAILMKAAPIGAFGAMAFTIGKYGISSVTNLAMLIGTFYIT
SALFVFVVLGAVCRYNGFSIVALIRYIKEELLLVLGTSSSEAALPGLMSKMEKAGCKRSV
VGLVIPTGYSFNLDGTNIYMTLAALFIAQATGIHLSFGEQILLLLVAMLSSKGAAGITGA
GFITLAATLSVVPSVPVAGMALILGIDRFMSECRALTNFVGNAVATIVVARWEGELDQEQ
LARVLSGKEEFTSIADVDALPASVQPAE