Protein Info for Atu3296 in Agrobacterium fabrum C58

Annotation: two component response regulator for C4-dicarboxylate transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 PF00072: Response_reg" amino acids 7 to 115 (109 residues), 97.3 bits, see alignment E=1.9e-31 PF00158: Sigma54_activat" amino acids 145 to 312 (168 residues), 220.6 bits, see alignment E=3.2e-69 PF14532: Sigma54_activ_2" amino acids 146 to 317 (172 residues), 52.8 bits, see alignment E=1.6e-17 PF07728: AAA_5" amino acids 168 to 286 (119 residues), 26.5 bits, see alignment E=1.7e-09 PF25601: AAA_lid_14" amino acids 318 to 375 (58 residues), 64.7 bits, see alignment 1.8e-21 PF02954: HTH_8" amino acids 401 to 440 (40 residues), 30.1 bits, see alignment 9.9e-11

Best Hits

Swiss-Prot: 71% identical to DCTD_RHIME: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 100% identity to atu:Atu3296)

Predicted SEED Role

"C4-dicarboxylate transport transcriptional regulatory protein dctD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEZ3 at UniProt or InterPro

Protein Sequence (454 amino acids)

>Atu3296 two component response regulator for C4-dicarboxylate transport (Agrobacterium fabrum C58)
MMADGTIFLVDDDSQLRKAMVQTLELDGLPVTSFSRAEQALAALNEDFDGIIITDVRMPG
MTGLEFFDHVRKIDADLPVILITGHGDVPMAVDALHNGAYDFIAKPFPAERMVESARRAL
EKRRLVLENRALRRAAGQAEDDLPLIGQTPAMERLRTTLRHIADTDVDVLVAGETGSGKE
VVATALHRWSKKRSKGNFVALNCGALPETVIESELFGHEPGAFTGAQKKRVGRIEHSSGG
TLFLDEIESMPLAVQVKMLRVLEMREVSPLGSNEERPVDIRVVAAAKVDLGDPAERGTFR
EDLYYRLNVVTLSIPPLRERKADIPLLFSHFVTKAANRFNMPVPQISAGTSRRLQDHDWP
GNVRELGHFAERVVLGLEAEPAAAPTSQSAIPASGTLPERMDEIEAHIIRETLERSNGDV
AETIATLGIARKTFYDKLQRHGINRADYVKNGTA