Protein Info for Atu3293 in Agrobacterium fabrum C58

Annotation: D-amino acid dehydrogenase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00070: Pyr_redox" amino acids 2 to 34 (33 residues), 22.5 bits, see alignment (E = 3.5e-08) PF01266: DAO" amino acids 3 to 398 (396 residues), 268.9 bits, see alignment E=2.4e-83 PF02558: ApbA" amino acids 3 to 38 (36 residues), 26.5 bits, see alignment 1.1e-09 PF13450: NAD_binding_8" amino acids 5 to 35 (31 residues), 27.2 bits, see alignment (E = 9.4e-10)

Best Hits

Swiss-Prot: 100% identical to DADA_AGRFC: D-amino acid dehydrogenase (dadA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00285, D-amino-acid dehydrogenase [EC: 1.4.99.1] (inferred from 100% identity to atu:Atu3293)

MetaCyc: 56% identical to D-amino acid dehydrogenase (Escherichia coli K-12 substr. MG1655)
RXN-11193 [EC: 1.4.5.1]; 1.4.5.- [EC: 1.4.5.1]

Predicted SEED Role

"D-amino acid dehydrogenase small subunit (EC 1.4.99.1)" in subsystem Pyruvate Alanine Serine Interconversions or Respiratory dehydrogenases 1 (EC 1.4.99.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.99.1

Use Curated BLAST to search for 1.4.5.1 or 1.4.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P58739 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Atu3293 D-amino acid dehydrogenase small subunit (Agrobacterium fabrum C58)
MNVTILGAGVVGVTSAWYLAKAGHKVTVIDRQPAAALETSFANAGEVSPGYSSPWAAPGI
PMKAMKWLFMKHAPLIIRPTADPAAWRWMSQMLRNCTSARYAINKSRMVRVAEYSRDCLM
ALREETGIDYDQRMQGTLEVFRTQKQFDAIGKDVDVLTAGGVPFEILDRDGCAAIEPGLA
PAKEKIVGGLRLPGDETGDCFMFTTELARMAEEAGVTFLYDTGIMRPIVEGGRIKAVETT
RGLIEADIFVAALGSYSPQFVRQLGLTLPVYPVKGYSITVPIVKEERAPVSTVMDETFKV
AITRLGSRIRAGGMAEIAGFSKDLPAARQETLAHSVEDLFGGAGDQSQAKFWCGLRPMTP
DGTPVIGATRYSNLYLNTGHGTLGWTMSCGSARVLADLISGNKPEIDTHDLAISRYAA