Protein Info for Atu3288 in Agrobacterium fabrum C58

Annotation: hydroxyethylthiazole kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02110: HK
  • amino acids 15 to 133 (119 residues), 102.2 bits, E=1.5e-33
  • amino acids 140 to 232 (93 residues), 77.2 bits, E=6.7e-26

Best Hits

Swiss-Prot: 100% identical to THIM_AGRFC: Probable hydroxyethylthiazole kinase (thiM) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00878, hydroxyethylthiazole kinase [EC: 2.7.1.50] (inferred from 100% identity to atu:Atu3288)

Predicted SEED Role

"Hydroxyethylthiazole kinase (EC 2.7.1.50)" in subsystem Thiamin biosynthesis (EC 2.7.1.50)

MetaCyc Pathways

• thiamine diphosphate salvage II (4/5 steps found)
• thiamine diphosphate salvage IV (yeast) (5/7 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (5/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.50

Sequence Analysis Tools

See Q8UAS9 at UniProt or InterPro

Protein Sequence (246 amino acids)

>Atu3288 hydroxyethylthiazole kinase (Agrobacterium fabrum C58)
MSGDFPTAARAAEILERVRQMRPRVHCLMNTVVQKFTADGITVIGGIPSMTTSLEEIESF
VTKADALTVNLGTLDAERRRVIRLAIEIANASGKPWIVDPVHVDYSPSRLDFARELIAQS
PTIVRGNRAEMSLIGDVPDVVRIETGPVDHLRDRTRNVSIVNGHPWMAKVTGTGCLSGGV
IAAFMAVEKDALTAAASALAVTGVSAELAAQRAKGPGTFEPAFLDALSEISGEDIINHAR
IEHEQG