Protein Info for Atu3287 in Agrobacterium fabrum C58

Annotation: thiamine biosynthesis associated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF13379: NMT1_2" amino acids 8 to 161 (154 residues), 26.6 bits, see alignment E=5e-10 PF09084: NMT1" amino acids 18 to 229 (212 residues), 246.3 bits, see alignment E=3.3e-77

Best Hits

Swiss-Prot: 52% identical to Y357_HAEIN: Putative thiamine biosynthesis protein HI_0357 (HI_0357) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to atu:Atu3287)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, substrate-binding component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CS34 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Atu3287 thiamine biosynthesis associated protein (Agrobacterium fabrum C58)
MQSEAADKLTVLLEWFVNPDHAPMVIATERGLFTDAGLEVELVPPADPSAVPRLVSAKQA
DIGVHYQPNLYLDHEAGLPLVRFGTLVETPLNTVTVLADGPIKSLKDLKGKKVGFSVSGF
EDAMLKRMLEKDGLTKDDVELINVNFSLSPSLIAGKVDATLGGFRNFELTQMKLEGHEGR
SFFPEEHGVPAYDELIFVTHTDLVKDSRLPRFLSAVEQAAIFITNHPQESWQLFIKAYPN
LNDALNKQAFFDTLPRFAKRPAALDRARYARFGAFMQEMQLIKQAPAADDIAVELQQP