Protein Info for Atu3266 in Agrobacterium fabrum C58

Annotation: dihydroorotase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 PF01979: Amidohydro_1" amino acids 66 to 374 (309 residues), 44.3 bits, see alignment E=2.2e-15 PF22647: EF_0837-like_N" amino acids 339 to 382 (44 residues), 27.9 bits, see alignment 3.2e-10

Best Hits

Swiss-Prot: 100% identical to DEACT_AGRFC: Deacetylase Atu3266 (Atu3266) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01465, dihydroorotase [EC: 3.5.2.3] (inferred from 100% identity to atu:Atu3266)

Predicted SEED Role

"Metallo-dependent hydrolases, subgroup B"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.3

Use Curated BLAST to search for 3.5.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CS13 at UniProt or InterPro

Protein Sequence (407 amino acids)

>Atu3266 dihydroorotase (Agrobacterium fabrum C58)
MTSGEQAKTPLQAPILLTNVKPVGFGKGASQSSTDILIGGDGKIAAVGSALQAPADTQRI
DAKGAFISPGWVDLHVHIWHGGTDISIRPSECGAERGVTTLVDAGSAGEANFHGFREYII
EPSRERIKAFLNLGSIGLVACNRVPELRDIKDIDLDRILECYAENSEHIVGLKVRASHVI
TGSWGVTPVKLGKKIAKILKVPMMVHVGEPPALYDEVLEILGPGDVVTHCFNGKSGSSIM
EDEDLFNLAERCAGEGIRLDIGHGGASFSFKVAEAAIARGLLPFSISTDLHGHSMNFPVW
DLATTMSKLLSVDMPFENVVEAVTRNPASVIRLDMENRLDVGQRADFTVFDLVDADLEAT
DSNGDVSRLKRLFEPRYAVIGAEAIAASRYIPRARKLVRHSHGYSWR