Protein Info for Atu3263 in Agrobacterium fabrum C58

Annotation: L-seryl-tRNA(Ser) selenium transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 PF03841: SelA" amino acids 14 to 265 (252 residues), 46.5 bits, see alignment E=4.1e-16 PF00266: Aminotran_5" amino acids 81 to 233 (153 residues), 31.7 bits, see alignment E=1.2e-11

Best Hits

Swiss-Prot: 64% identical to Y3804_RHILO: Uncharacterized protein mlr3804 (mlr3804) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K01042, L-seryl-tRNA(Ser) seleniumtransferase [EC: 2.9.1.1] (inferred from 100% identity to atu:Atu3263)

Predicted SEED Role

"D-Glucosaminate-6-phosphate ammonia-lyase (EC 4.3.1.-)" (EC 4.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.9.1.1 or 4.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEY1 at UniProt or InterPro

Protein Sequence (398 amino acids)

>Atu3263 L-seryl-tRNA(Ser) selenium transferase (Agrobacterium fabrum C58)
MTEDIRSRIGLRPVINVSGTMTSLGASIVVPEAVEAMAAILPQFVEINDLQRKASAIIAR
LTGGEAGFVTASCSSGISLAVAGAITGNNLLAIEKLPDIAPEKNEVLVQMGHVVSYGAPV
DQAIRLGGGKVVLVGQATSTHRYHMENAITEKTAAAVYVVSHHVVDYGLLHLSEFVEIAH
AKGVPVIVDAASEYDLELFLATGADVVLYSGHKFLGGPTSGIVAGSKELVRHAFLQNMGI
GRGMKVGKESIYGVMAALEAWEKRDHAGIRERETGYLNLWKKTLDGRPGVTALIEPDPTN
NPLDRMRVIIDADEAHITAWDLTTALARGNPPIITRDHEVEHRYFYLDPCNLHPGQETIV
ASRLAEELDKARASNEMIATPFEDRSRHRFDGMLCWPD