Protein Info for Atu3262 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 611 PF00005: ABC_tran" amino acids 36 to 194 (159 residues), 101.5 bits, see alignment E=1.9e-32 amino acids 339 to 488 (150 residues), 113.3 bits, see alignment E=4.2e-36 PF08352: oligo_HPY" amino acids 245 to 277 (33 residues), 30.4 bits, see alignment (E = 1.2e-10) amino acids 541 to 583 (43 residues), 35.3 bits, see alignment 3.7e-12

Best Hits

Swiss-Prot: 58% identical to GSIA_PECAS: Glutathione import ATP-binding protein GsiA (gsiA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to atu:Atu3262)

MetaCyc: 59% identical to glutathione ABC transporter ATP binding subunit GsiA (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Putative glutathione transporter, ATP-binding component" in subsystem Utilization of glutathione as a sulphur source

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEY0 at UniProt or InterPro

Protein Sequence (611 amino acids)

>Atu3262 ABC transporter permease (Agrobacterium fabrum C58)
MTMPQAAPLGAEDAVLSVRNLTTSFHVDGGWKPVVRDISFDVGPGETVAIVGESGSGKSV
TSLSIMRLLDRESSRVQGEILLGGRNLLSLSEDAMRRVRGNEVAMIFQEPMTSLNPLFTI
GDQISEALLCHQPMSKAEARAETVRLLEKVRIPSAASRFDEYPHRFSGGMRQRVMIAMAL
ASKPKLLIADEPTTALDVTIQGQILDLIKTLQEEEGTSVLFITHDMGVVAEIADRTVVMY
RGEQVEVGATADIFHRGKHPYTRALLSAVPVLGSMKGEERPLRFPIVNTATGETQEPVRP
ADTVDASAQPVLKVEGLTKRFDIHSGLLGRLSGRVHAVENVSFDLRAGETLSLVGESGCG
KSTTGRAIMRLIEPDAGSVVVNGENILTLDKSGMREMRKTVQMIFQDPFASLNPRMTVGA
AIAEPFLEHRMGSAREAKEVVADMLNKVGLSPDMAARYPHEFSGGQRQRICIARALALQP
KVIVADESVSALDVSIKAQVINLMLDLQQSLDLAFLFISHDMAVVERVSHRVAVMYLGEI
VEIGPRADVFDNPQHDYTRKLMAAVPVPDPDRRNTRRGAANDELKSPIRPVDYTANPRAY
REVSPGHLVAL