Protein Info for Atu3261 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 transmembrane" amino acids 25 to 51 (27 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 104 to 128 (25 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 199 to 227 (29 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details amino acids 361 to 384 (24 residues), see Phobius details amino acids 404 to 425 (22 residues), see Phobius details amino acids 431 to 450 (20 residues), see Phobius details amino acids 462 to 482 (21 residues), see Phobius details amino acids 502 to 541 (40 residues), see Phobius details amino acids 543 to 573 (31 residues), see Phobius details amino acids 581 to 605 (25 residues), see Phobius details PF04290: DctQ" amino acids 38 to 158 (121 residues), 70.1 bits, see alignment E=1.7e-23 PF06808: DctM" amino acids 203 to 600 (398 residues), 291.7 bits, see alignment E=9.1e-91 TIGR00786: TRAP transporter, DctM subunit" amino acids 211 to 601 (391 residues), 292.7 bits, see alignment E=2e-91

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3261)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEX9 at UniProt or InterPro

Protein Sequence (606 amino acids)

>Atu3261 ABC transporter permease (Agrobacterium fabrum C58)
MAVAEKQRRKGFETAAAVMLSRFDAVLGAVAALILAALLLVVLINVTLRYLFHTGFIGAE
DLGIWLNVAMIAVGAPLSLKSALAMRLDVFVRFLPPRFHAATEILADAFSFVAALILALG
GVEIAAMLGGTSPTLGLPEWVRFGFLGAGGALIFVYLTLQRFSEGKTFAVLLSMTIALVA
YVGLPQIFVDTTLPPSLFLALTAAVGLVLAAPLAHAFLAAAYVAIAFGSTLPEPAIVSST
VTGMSKFLLLAIPFFLLAGSLLTISGVANQLVRFAASVVGHRRAGLAQTTLLTSVLFSGA
SGSSVANAAFGASTFQPELVKHGYPPAQAGAIIAATSVLDNVIPPSIAFLILATATNLSV
GSLLVGGFFAGGLMAVCLGVAIHLSVRSVDTLPRATGAERWRSAIAAIPAFGLGVIVVVG
IRIGIVTTTEAAALAALYTLLLGFGYRLGVGRIFATFRQSAGEAAAIGLLIGTAGPFAFL
LAVDNVSGLVTDFVTVLGGSKITVLLLSNLILLAVGLVLDIGAAILLFGPILLPAAVAAG
IDPIHFGVILVVNLMIHGLTPPLGMLIFVVSGVTRVPAAALFRAVIPYLVSLLVALAILC
LWAILF