Protein Info for Atu3256 in Agrobacterium fabrum C58

Annotation: zinc-binding dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF08240: ADH_N" amino acids 26 to 139 (114 residues), 104.2 bits, see alignment E=5.1e-34 PF00107: ADH_zinc_N" amino acids 181 to 305 (125 residues), 81.1 bits, see alignment E=1.1e-26 PF13602: ADH_zinc_N_2" amino acids 214 to 340 (127 residues), 39.9 bits, see alignment E=1.3e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3256)

Predicted SEED Role

"L-idonate 5-dehydrogenase (EC 1.1.1.264)" in subsystem D-gluconate and ketogluconates metabolism (EC 1.1.1.264)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.264

Use Curated BLAST to search for 1.1.1.264

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEX7 at UniProt or InterPro

Protein Sequence (348 amino acids)

>Atu3256 zinc-binding dehydrogenase (Agrobacterium fabrum C58)
MQTRVARLYSREDIRVETQDVAPPGPGEVLLAMAAGGICGSDLHYYQDGGFGPVRVREPI
ICGHEASGHIAALGAGVSGLAIGQLVAVNPSQPCGHCQFCLKGQPIHCLDMRFMGSAMRL
PHEQGMFRDRLVVPAKQCATFSDATSPAEAACTEPLAVCLHAVAQAGDLAGAKVLVTGAG
PIGLLTIAAARQAGAGIIVATDLTDAALERAPAMGADRTINVAKDADALLPYQDNKGYFD
VIFDCSAAGPALRSAFACVRPRGTIVQVGVTGDVTIPLNALVGKEIVWRGSQRFHDEFAI
AAGLISSRKIDVRPIISHSFPLGDAKAAFEQAGDRSAACKVQLTFSAD