Protein Info for Atu3238 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 175 to 199 (25 residues), see Phobius details amino acids 227 to 252 (26 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 105 to 303 (199 residues), 26.7 bits, see alignment E=2.1e-10

Best Hits

Swiss-Prot: 35% identical to MSMF_STRMU: Multiple sugar-binding transport system permease protein MsmF (msmF) from Streptococcus mutans serotype c (strain ATCC 700610 / UA159)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu3238)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CRY9 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Atu3238 sugar ABC transporter permease (Agrobacterium fabrum C58)
MTDISMTSASIPARRAAKRKQSSVAHDRALTLLVFLPPALLLFTLFVILPMGEAAWYSLY
RWNGYGTPTDFVGLKNFQVLFGNAAFSQALMNNGLIILISILIQIPLAIWLAMMLAHRIP
GVVAFRLVFFLPYVLADVAAGLIWRFVYDGDYGLFAAISNFFGFANPYVLADKDVAIYAV
LGVIVWKYFGFHMMLFIAGLQSVDKNVLEAAEIDGASGWQKFRYVTLPMLGSTVRLSVFF
AVIGSLQLFDMIMPLTGGGPSNSTQTMVTFLYTYGVMRMQVGLGSAVGVVLFVICVTLAF
GYKRIFMRHD