Protein Info for Atu3237 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 16 to 41 (26 residues), see Phobius details amino acids 76 to 102 (27 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 174 to 190 (17 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 94 to 271 (178 residues), 55.2 bits, see alignment E=3.8e-19

Best Hits

Swiss-Prot: 33% identical to YOR2_CALSR: Putative ABC transporter permease protein ORF2 from Caldicellulosiruptor sp. (strain Rt8B.4)

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu3237)

Predicted SEED Role

"ABC-type sugar transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEW6 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Atu3237 sugar ABC transporter permease (Agrobacterium fabrum C58)
MTDTSTSVRMPLQTKLYLYISLSLIAAIVLIPLLTTALGGFKTLGDLRVNPFGIPAEWQW
ANYGDILFGKRYWLQIFNSLVIALLTVFLTLTVSAMAAFTFAHVKFFGSSFLLNYFLLGL
MFPAATAILPLFIRIRDLGLLDTYWGVVLPQVAFGLGMSILLFRNYFRNLPDELFQAAFV
DGCGYLRFFWHISVPLSRPIVATVGIVSFVGSWNSYILPLIMLNSESKYPWPLGIMVYRG
EFGTEWQLVLAFITLTILPTVIVFFLAQKHIIAGLTAGAVKS