Protein Info for Atu3217 in Agrobacterium fabrum C58

Annotation: aspartate aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00266: Aminotran_5
  • amino acids 27 to 310 (284 residues), 98.8 bits, E=1.8e-32

Best Hits

KEGG orthology group: K00839, aminotransferase [EC: 2.6.1.-] (inferred from 100% identity to atu:Atu3217)

Predicted SEED Role

"FIG00984142: hypothetical protein"

KEGG Metabolic Maps

• Aminophosphonate metabolism
• Arginine and proline metabolism
• Caprolactam degradation
• Lysine biosynthesis
• Lysine degradation
• Methionine metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.-

Use Curated BLAST to search for 2.6.1.-

Sequence Analysis Tools

See A9CEV5 at UniProt or InterPro

Protein Sequence (372 amino acids)

>Atu3217 aspartate aminotransferase (Agrobacterium fabrum C58)
MPAPDYALLLDPPAFPAERYAMLADRLAALMGTKNDVLLIQAEAVLALEAAATSLARPGL
RALNIITSPYGAWFGGWLERGGATVRNLTASPAKPVTLAEVERALDDGPGFDLLAIVHAE
SASGILNPLPAIAALAQTRGVVTLVDAVASIGGHAFEVDQLGIDIAVIGPQKALAGPAGV
SAISVSPKAWEFLSHDKAPTNSMLSLLDQKQLWLDAGRGALPGTPAPLEFYALDAALDRI
EAEGLPAANARHERAAAATRHGIRALGIANWVEETHASALVSTAVLPDSVEAGAFHAAVS
RQHGADISVGVGPGAERLIRLNHTGRRAHPQAVKANIAAVANALKTLGHSTNTDSALEAA
EKGYSEAPAKEV