Protein Info for Atu3214 in Agrobacterium fabrum C58

Annotation: oligopeptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 39 to 57 (19 residues), see Phobius details amino acids 78 to 103 (26 residues), see Phobius details amino acids 123 to 149 (27 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 239 to 262 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 92 to 269 (178 residues), 95 bits, see alignment E=2.5e-31

Best Hits

Swiss-Prot: 44% identical to Y4TQ_SINFN: Probable peptide ABC transporter permease protein y4tQ (NGR_a01420) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu3214)

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEV2 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Atu3214 oligopeptide ABC transporter permease (Agrobacterium fabrum C58)
MNFALRLLRSFEGVTGFIILALLVVTALAAPLAFPGDPLAIIGEPLIAPFTDAALPLGTD
RLGRNVLAELAHGAQASLLVGMGAAAAALVIGTVIGTIAGFAGGLVDEALMRVTDAFQIV
PNFLLALAFVSTIGPSMPIVILAIALGAWADPARLMRAQVLSIRERDYVQSARAIGMHPL
EIAFRQILPNALPPVLALAAIIVAAAILTEAALSFLGLGDPNIVTWGSMIAEGRNVLRSA
AFLSVIPGIGLLVTVLGVYLFGEGINRAMATRRQAP