Protein Info for Atu3214 in Agrobacterium fabrum C58
Annotation: oligopeptide ABC transporter permease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 44% identical to Y4TQ_SINFN: Probable peptide ABC transporter permease protein y4tQ (NGR_a01420) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)
KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu3214)Predicted SEED Role
"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A9CEV2 at UniProt or InterPro
Protein Sequence (276 amino acids)
>Atu3214 oligopeptide ABC transporter permease (Agrobacterium fabrum C58) MNFALRLLRSFEGVTGFIILALLVVTALAAPLAFPGDPLAIIGEPLIAPFTDAALPLGTD RLGRNVLAELAHGAQASLLVGMGAAAAALVIGTVIGTIAGFAGGLVDEALMRVTDAFQIV PNFLLALAFVSTIGPSMPIVILAIALGAWADPARLMRAQVLSIRERDYVQSARAIGMHPL EIAFRQILPNALPPVLALAAIIVAAAILTEAALSFLGLGDPNIVTWGSMIAEGRNVLRSA AFLSVIPGIGLLVTVLGVYLFGEGINRAMATRRQAP