Protein Info for Atu3213 in Agrobacterium fabrum C58

Annotation: oligopeptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 103 to 126 (24 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 214 to 231 (18 residues), see Phobius details amino acids 247 to 272 (26 residues), see Phobius details amino acids 292 to 317 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 118 to 322 (205 residues), 130.7 bits, see alignment E=5.5e-42

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu3213)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEV1 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Atu3213 oligopeptide ABC transporter permease (Agrobacterium fabrum C58)
MRRAATLLRRRAISAIPVLLIVLIFTFVLLENASGDAVDAYLVSIGGGDAGLRDALREQY
GLNGSMLARFWLYASSVLRLDFGWSLAFDRPVLGLILERLPNTLLLMGSATALAFILGTT
LGIVAGARPGGLMDRVLSTLSLALYATPGFWLGLVLAIVFAVQLRWLPTSGIETIASGKQ
GFARALDIARHLVLPVASLGLIYLALFLRVMRTAMAAIWPLDFVLFAEAKGLSRRRIVLR
HVARNAALPLVTVLGLQAATMLGGSVVIESVFAIPGFGRLAQEAVSGRDTPLLMGIILTS
AVFVILVNLAVDILYAVFDPRIGSGESAA