Protein Info for Atu3204 in Agrobacterium fabrum C58

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 PF13426: PAS_9" amino acids 83 to 175 (93 residues), 11.1 bits, see alignment E=6.3e-05 amino acids 243 to 335 (93 residues), 25.2 bits, see alignment E=2.5e-09 PF08448: PAS_4" amino acids 238 to 337 (100 residues), 27.4 bits, see alignment E=5.1e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 343 to 494 (152 residues), 101.1 bits, see alignment E=5.6e-33 PF00990: GGDEF" amino acids 348 to 494 (147 residues), 112.9 bits, see alignment E=2.1e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3204)

Predicted SEED Role

"FOG: PAS/PAC domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEU9 at UniProt or InterPro

Protein Sequence (525 amino acids)

>Atu3204 diguanylate cyclase (Agrobacterium fabrum C58)
MRTAVAVPYHSGIRLPLLFEKNARMTETIDTNVFNLAPVAMWIEDFSEVKSQFDIWRAEG
IEDIRAFLLEDLSRVAACSQKIRVIEVNAKTLELFEARDQAHLVDNLHRIFRDDMLESHV
NELSELWAGRTEFTSNAVNYSIGGRRLDIQLRGTVIPGHEDTLGRLLLTTEDVTEREEAR
RKELLNRRYAEGMFKHSPVSLWVEDFSRVRRLIEEVRERGIVDFRVFMDVHPEFVRQCMS
EIRVIDVNQATLDLFCAADRQVLLQRLGDIFRGEMEKPFREQLIELWNGNLTHHREVVNY
ALDGSERHVLLHFSVFPGHERDWSLVQVALTDITARKKAEAYLEYLGKHDVLTKLHNRAF
YSDELNRLERSALRPVSAIVIDLNGLKEANDKLGHDAGDALLRRVGEVLNGVVTAPNHAA
RIGGDEFAILLPGADKQVAAAMVDTVYELLKINNQFYSSAPLSLSLGVATTEAGETMESL
VRRADMNMYEQKNAYYAALRNRSADNNDTTKGGSQSETTSLKRLF