Protein Info for Atu3192 in Agrobacterium fabrum C58

Annotation: MFS permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 18 to 40 (23 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 273 to 300 (28 residues), see Phobius details amino acids 309 to 355 (47 residues), see Phobius details amino acids 367 to 390 (24 residues), see Phobius details amino acids 397 to 418 (22 residues), see Phobius details PF07690: MFS_1" amino acids 26 to 383 (358 residues), 136.3 bits, see alignment E=6.1e-44

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3192)

Predicted SEED Role

"MFS permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CRU9 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Atu3192 MFS permease (Agrobacterium fabrum C58)
MLSTRLASWMAGRNLHYGWVVAVTTFLTMLATAGAMGSAGVMIQPLHQEFGWDIADISSA
MAVRLVLFGLLGPFAAAFMNHFGIRQVVSTALALIMGGIVASFFMTQVWQLLLLWGVVIG
VGTGMTALVLGATVASRWFSKRRGLVIGLMTASNATGQLVFLPLLAALTEAYGWRTALTL
SVAVIAAAMILVLLLMRDHPSDVGLPAYGETAVSKPPKQDHNLLATLASPLVTLKSVSGN
PVFWVLFGTFFVCGLSTNGLIQTHWISICGDFGMAAVTAAGTLAVIGIFDFFGTIFAGWL
SDRFDNRFLLFWFYGLRGLSLIYLSFSGFSFVELSVFAVFYGLDWVATVPPTVKLAAENF
GREKAGLVFGWVFAGHQLGAATAAFGAGFFKSDFDTYMPALQIAGLMCLIAAFSVLLLRK
PGSAALTPQAA