Protein Info for Atu3191 in Agrobacterium fabrum C58

Annotation: outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13505: OMP_b-brl" amino acids 31 to 228 (198 residues), 39 bits, see alignment E=9.9e-14 PF03922: OmpW" amino acids 69 to 228 (160 residues), 155.6 bits, see alignment E=1.6e-49

Best Hits

Swiss-Prot: 70% identical to Y4MB_SINFN: Uncharacterized outer-membrane protein y4mB (NGR_a02570) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K07275, outer membrane protein (inferred from 100% identity to atu:Atu3191)

Predicted SEED Role

"Outer membrane protein W precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEU3 at UniProt or InterPro

Protein Sequence (228 amino acids)

>Atu3191 outer membrane protein (Agrobacterium fabrum C58)
MTKMNRKTALLASVAAMMMVNGALAADLAPLATAPTAEQAIAAASPWMLRVRGLGVITND
SGSVDGLPGAGLSYSDTVIPELDISYFFTDNFAAELILGTTYAKINGEGVLAGTPVGKTW
LLPPTLTLQYHFTDFGAFKPYIGAGVNYSLFYNQSEKPGFSNLDVKNKLGAAVQVGFDYM
LDEHWGVNFDVKKIFLKTDWTAELGGTPISGKAKLDPWLIGAGITYRF