Protein Info for Atu3172 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 87 to 269 (183 residues), 83.3 bits, see alignment E=9.1e-28

Best Hits

Swiss-Prot: 41% identical to MALG_THELN: Trehalose/maltose transport system permease protein MalG (malG) from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu3172)

MetaCyc: 34% identical to ABC-type 3-(6-sulfo-alpha-D-quinovosyl)-sn-glycerol transporter permease subunit (Agrobacterium fabrum)
7.5.2.M1 [EC: 7.5.2.M1]

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CET1 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Atu3172 sugar ABC transporter permease (Agrobacterium fabrum C58)
MASKIVFTFAHRLAILAYIVFALFPLFWLLKVSVTPNDLLYSEGVRMWPSHATLDHYRYV
IENSAFPTFFKNSVIVAGSTALAVTVLSSLSGYALSRFRFKGKYWIVALMLITQMFPLVM
LVAPIFKMLSPLGLTNSLTGLVIVYTAFNVPFATFLMQSFFDGIPKDLEEAAMIDGASRF
TAFRQIILPLTLPGIAATLGFVFTAAWSELLFALMLISGNQSATFPVGLLTFVSKFSVDF
GQMMAAGVLALIPACLFFLLIQRYLVQGLTAGAVKG