Protein Info for Atu3167 in Agrobacterium fabrum C58

Annotation: tagatose 6-phosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08013: GatZ_KbaZ-like
  • amino acids 5 to 420 (416 residues), 590.3 bits, E=9.4e-182
• TIGR02810: D-tagatose-bisphosphate aldolase, class II, non-catalytic subunit
  • amino acids 7 to 420 (414 residues), 644.6 bits, E=3.5e-198

Best Hits

Swiss-Prot: 100% identical to TAGPE_AGRFC: D-tagatose 6-phosphate 4-epimerase (Atu3167) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00917, tagatose 6-phosphate kinase [EC: 2.7.1.144] (inferred from 100% identity to atu:Atu3167)

MetaCyc: 100% identical to D-tagatose 6-phosphate 4-epimerase (Agrobacterium fabrum C58)
RXN-18477 [EC: 5.1.3.40]

Predicted SEED Role

"6-phosphofructokinase (EC 2.7.1.11), PF08013 family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 2.7.1.11)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• glycolysis IV (9/10 steps found)
• homolactic fermentation (10/12 steps found)
• D-altritol and galactitol degradation (4/4 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (13/17 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (3/4 steps found)
• glycolysis II (from fructose 6-phosphate) (8/11 steps found)
• glycolysis I (from glucose 6-phosphate) (9/13 steps found)
• N-acetyl-D-galactosamine degradation (3/5 steps found)
• galactitol degradation (3/5 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• 1,3-propanediol biosynthesis (engineered) (5/9 steps found)
• lactose degradation I (2/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (10/19 steps found)
• superpathway of N-acetylneuraminate degradation (12/22 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.11 or 2.7.1.144 or 5.1.3.40

Sequence Analysis Tools

See A9CES6 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Atu3167 tagatose 6-phosphate kinase (Agrobacterium fabrum C58)
MTAILENLAAARRAGKPAGITSVCSAHPVVLRAAIRRAAASQTAVLIEATCNQVNHLGGY
TGMTPRDFVAFVNSIAAEEGLPAELLIFGGDHLGPNPWRREKAEDALTKAAAMVDAYVTA
GFRKIHLDASMGCAGEPAALDDVTIAHRAAKLTAVAEKAATEAGLPKPLYILGTEVPVPG
GADHVLETVAPTEPQAARNTIDLHREIFAQHGLSDAFERVIAFVVQPGVEFGSDNVVAYD
PQAAQSLSAVLDGEPRLVFEAHSTDYQTEPALAALVRDGYPILKVGPGLTFAYREALYAL
DMIASEMVGTYGDRPLARTMEKLMLSAPGDWQGHYHGDDITLRLQRHYSYSDRIRYYWTR
PEALAAVSTLHKALDGKTIPETLLRQYLGELPLAAVAGKEPEEVLVAAVDQVLATYHAAT
GEGRH