Protein Info for Atu3164 in Agrobacterium fabrum C58

Annotation: sorbitol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00106: adh_short" amino acids 6 to 191 (186 residues), 180.2 bits, see alignment E=4.8e-57 PF08659: KR" amino acids 8 to 158 (151 residues), 38.1 bits, see alignment E=2.3e-13 PF13561: adh_short_C2" amino acids 12 to 252 (241 residues), 191.3 bits, see alignment E=3.1e-60

Best Hits

Swiss-Prot: 100% identical to GDH_AGRFC: Galactitol 2-dehydrogenase (Atu3164) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00008, L-iditol 2-dehydrogenase [EC: 1.1.1.14] (inferred from 100% identity to atu:Atu3164)

MetaCyc: 100% identical to galactitol 2-dehydrogenase (Agrobacterium fabrum C58)
Galactitol 2-dehydrogenase. [EC: 1.1.1.16]

Predicted SEED Role

"Sorbitol dehydrogenase (EC 1.1.1.14)" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.14

Use Curated BLAST to search for 1.1.1.14 or 1.1.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CES4 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Atu3164 sorbitol dehydrogenase (Agrobacterium fabrum C58)
MRLNNKVALITGAARGIGLGFAQAFAAEGAKVIIADIDIARATTSAAAIGPAAKAVKLDV
TDLAQIDAVVKAVDEEFGGIDILVNNAAIFDMAPINGITEESYERVFDINLKGPMFMMKA
VSNVMIARARGGKIINMASQAGRRGEALVTLYCASKAAIISATQSAALALVKHGINVNAI
APGVVDGEHWEVVDAHFAKWEGLKPGEKKAAVAKSVPIGRFATPDDIKGLAVFLASADSD
YILAQTYNVDGGNWMS