Protein Info for Atu3135 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 7 to 36 (30 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 81 to 92 (12 residues), see Phobius details amino acids 95 to 95 (1 residues), see Phobius details amino acids 97 to 122 (26 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 301 to 331 (31 residues), see Phobius details amino acids 334 to 368 (35 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details amino acids 397 to 421 (25 residues), see Phobius details PF06808: DctM" amino acids 7 to 416 (410 residues), 382.4 bits, see alignment E=1.3e-118 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 422 (406 residues), 447.8 bits, see alignment E=1.5e-138

Best Hits

Swiss-Prot: 36% identical to YIAN_ECOLI: 2,3-diketo-L-gulonate TRAP transporter large permease protein YiaN (yiaN) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to atu:Atu3135)

MetaCyc: 36% identical to 2,3-diketo-L-gulonate:Na+ symporter - membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-235

Predicted SEED Role

"TRAP-type transport system, large permease component, predicted N-acetylneuraminate transporter" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEQ6 at UniProt or InterPro

Protein Sequence (426 amino acids)

>Atu3135 ABC transporter permease (Agrobacterium fabrum C58)
MAYTILFGVFTLLMLIGTPIAFCLGIASFATVLYLGLPPIVVFQQMNSGMNVFAMMAIPF
FIFAGDLMVRGGIAHRLIRFAAGLVGHLRGGLGQVNIVASTLFGGISGSAVADASAVGGL
MIPQMAKRGYDKDYAVNVTVNAAIIALMIPPSHNMILYSIAAGGNVSVADLFTAGIIPGL
LLAAALMVTAYIVARRKGYPSEPFPGFSKLMYYLLASFPGILLIGIIFGGVRSGIFTATE
SSCIAVLYAFLVAMLVYRELNWDGFVEAVMGAVRTTAMVLLVIGTAASFGWLMAFLQVQT
LMIAAISAISDNPIIVLLVINVILLLLGTFMDMAPMVIISTPVLLPVVKAFGIDPVHFGV
VMILNAGIGLNTPPVGTVLFVGCAVGGITIREAMRTIWPFFGASIAVLLAVTYIPSLSLW
LPSLFR