Protein Info for Atu3132 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 87 to 112 (26 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 107 to 284 (178 residues), 58.9 bits, see alignment E=2.9e-20

Best Hits

Swiss-Prot: 41% identical to YESQ_BACSU: Probable ABC transporter permease protein YesQ (yesQ) from Bacillus subtilis (strain 168)

KEGG orthology group: K10194, oligogalacturonide transport system permease protein (inferred from 100% identity to atu:Atu3132)

Predicted SEED Role

"Putative sugar ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEQ4 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Atu3132 sugar ABC transporter permease (Agrobacterium fabrum C58)
MTDIATLNDMQAARRARLRLLSTSVRYVLLFAVGLVMLYPLIWLVGASFKTNSEIFSGAG
FIPENPTLDGYIRGWQTSTPYTFGRFFWNSFLIILPKVIGTAISCTMAAYAFARFDFPLK
KILFGSVIAILLLPNVVTRIPQYILFRDLGWLDSFLPLWVPSAFAGDAFFVFMLVQFLRS
LPSDMEEAARVDGANSLQALIYIVVPMLAPALISVCLFQFMWTMNDFLGPLIYLSSVDKY
PVSLALKLSIDTTEAFEWNRILAMSVLTIAPALIVFFAAQRYFIEGISSGGVKG