Protein Info for Atu3131 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF00005: ABC_tran" amino acids 21 to 162 (142 residues), 100.9 bits, see alignment E=1.4e-32 PF08402: TOBE_2" amino acids 283 to 356 (74 residues), 34.1 bits, see alignment E=3.6e-12

Best Hits

Swiss-Prot: 51% identical to UGPC_CHRVO: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K10195, oligogalacturonide transport system ATP-binding protein (inferred from 100% identity to atu:Atu3131)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEQ3 at UniProt or InterPro

Protein Sequence (366 amino acids)

>Atu3131 sugar ABC transporter ATPase (Agrobacterium fabrum C58)
MASVQLKNLEKVYGGSFKAVHGINLDVEDGEFMVFVGPSGCAKSTTLRMVAGLEEITGGE
ILIGDQRVNDLPPGKRSIAMVFQNYALYPHMKVRGNLAFGLKIAGVAKPEIEKAIDDVAR
ILEIEPLLDRLPKQLSGGQAQRVALGRALIKKPGVFLFDEPLSNLDAKLRASMRVRITDL
HRQLKAEGLSSTVIYVTHDQTEAMTMGDRICVMQAGRIMQVATPKELYNRPANLFVAGFI
GMPEMNLVDVAIDGAEFVIGGQRLPIGGHLEQRLSARPADAVIGIRPQHLSLAGEAGGPA
LEAKLTNAEFMGHEVYLHADLGGQKLVSVVGAAEFEALGRDGILRLKPDPEKLHIFDKAD
GRNVSL