Protein Info for Atu3128 in Agrobacterium fabrum C58

Annotation: di-trans,poly-cis-decaprenylcistransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 195 to 214 (20 residues), see Phobius details PF07470: Glyco_hydro_88" amino acids 18 to 361 (344 residues), 267 bits, see alignment E=1.2e-83

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3128)

Predicted SEED Role

"Rhamnogalacturonides degradation protein RhiN" in subsystem D-Galacturonate and D-Glucuronate Utilization or L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>Atu3128 di-trans,poly-cis-decaprenylcistransferase (Agrobacterium fabrum C58)
MKATEYFDQFSRRYKHYKGGSWCYEDGCVYRGLQQLLEATGEARWNDHLHRLADPQIGAD
GTLAGYDPQEYNIDHILAGRILFPLSAQTGDARYLAAAGHLAGQLRSHPRTNAGNYWHKK
RYPHQVWLDGLYMGLPFQIEYGQTTGRPELIEDALRQFSAALALTADAGGLYVHGYDESR
NQRWANPASGKSPAIWARAVGWLAMALVDALVILPDDSATAELRERTRRLLAGIIARQTQ
AGLWMQVLDNQGLAGNYAETSASAMFAYALLRAARLGLLRGEEAKAALSAGRQALAALLE
TRLELDEQGVARLTGIVHVAGLGGFDGNYRDGTPDYYLTEPVVSDDAKGVGPLMMAYAES
LLLAR