Protein Info for Atu3103 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF00005: ABC_tran" amino acids 19 to 160 (142 residues), 121 bits, see alignment E=9.1e-39 PF17912: OB_MalK" amino acids 234 to 287 (54 residues), 43.9 bits, see alignment 5.4e-15 PF08402: TOBE_2" amino acids 280 to 349 (70 residues), 36.5 bits, see alignment E=6.6e-13

Best Hits

Swiss-Prot: 57% identical to LACK_RHIRD: Lactose transport ATP-binding protein LacK (lacK) from Rhizobium radiobacter

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 100% identity to atu:Atu3103)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEP0 at UniProt or InterPro

Protein Sequence (357 amino acids)

>Atu3103 sugar ABC transporter ATPase (Agrobacterium fabrum C58)
MGVRLNNIAKSFGSFAAIRDVSMEIPTGSFAVFVGPSGCGKSTLLRMIAGLEETSGGRIA
IDDRDVTAVEPAERGVAMVFQNYALYPHLSVFENMAFSLRLARRPKAEVNERVGEAARIL
QLEDHLHKKPSQLSGGQRQRVAIGRAIVRQPKVFLFDEPLSNLDAELRVQMRLELTRLHR
KLGATMIYVTHDQVEAMTLADKIFVLKGGVVQQAGAPLTLYDDPDNRFVAGFIGSPAMNF
LQAEIVEQRNGVVTLSLDGGQRHLEARLSQPVSVGQRVEIGVRPEHLTIAQEGALPVNVE
VAEELGDVSYLYTRATSGKEIIVQRQGSRESLDGRSVLLSASPDHIMVFDSDGKRLR