Protein Info for Atu3100 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 70 to 94 (25 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 263 (178 residues), 42.5 bits, see alignment E=3.1e-15

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu3100)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEN8 at UniProt or InterPro

Protein Sequence (275 amino acids)

>Atu3100 sugar ABC transporter permease (Agrobacterium fabrum C58)
MSLTRRLENIILTVLTFSAALVWIFPLYWTFVTSIRSDENVAGNTSLIPDEFRLSAYVSA
IFNTKLMNWYINSVGTAAIVTVSVLLISMLCAYALSQIRFPGRRLLYGIVLASFMVPAQT
LVVTQFILMKNLNLINTWAGIILPQLITPIVIIVYKQFFDSVPKEMREAVVLDGGGEYTI
LFKVYLPLNWGITTAMAIVTFITVWNAFFWPFLVVTSEDMMTIPVGITQVNDTFGVAYAR
LMAIAMLAALPVIIAYVVFQRRVTEAIMISSGVKG