Protein Info for Atu3098 in Agrobacterium fabrum C58

Annotation: sn-glycerol-3-phosphate ABC transporter membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 75 to 99 (25 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 262 to 285 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 87 to 289 (203 residues), 47.2 bits, see alignment E=1.1e-16

Best Hits

KEGG orthology group: K05815, sn-glycerol 3-phosphate transport system permease protein (inferred from 100% identity to atu:Atu3098)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEN7 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Atu3098 sn-glycerol-3-phosphate ABC transporter membrane protein (Agrobacterium fabrum C58)
MIQRTPYADALTYAIMVAGFLLLIGPFLVVISGASQSVQQVNSVPFSFMPQGEFLANAQT
AWARANLGNALWNSLIMATLVTIGKVALSAFTAFAIVFFRSPLKHLFFWTVFITLMLPLE
VRVVPTYSVAADLFQPLRSILGLFGIEMTLEWNLLNSYAGLTLPLVATATGTFLYRQFFM
TIPDELAEAARMDGSGAARFFVDMLLPLSRTNMLALTTIMFVYAWNQYLWPLLMVTDPSY
KTVMMSLRALLPADDGTPDWNVTLAGSLIIILPPLFVVAFLQRWFVRGLVSSDK