Protein Info for Atu3097 in Agrobacterium fabrum C58

Annotation: sn-glycerol-3-phosphate ABC transporter membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 70 to 96 (27 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 85 to 291 (207 residues), 41.3 bits, see alignment E=7.1e-15

Best Hits

Swiss-Prot: 40% identical to UGPA_YERPE: sn-glycerol-3-phosphate transport system permease protein UgpA (ugpA) from Yersinia pestis

KEGG orthology group: K05814, sn-glycerol 3-phosphate transport system permease protein (inferred from 100% identity to atu:Atu3097)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEN6 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Atu3097 sn-glycerol-3-phosphate ABC transporter membrane protein (Agrobacterium fabrum C58)
MEKRTVFKSTWLPVLFALPQFLLILLFFYWPVVAVLNWAFTLEPPFGGPAEFVGLANFVE
TFGDPIYWQSIVTSLTFAIVGPFFAILIGLVLALAVDRQLPGSGFFRVLYILPYAIAGPA
AGMAFRFILSPERGLAASLNAWWPDIWNPAKYNEHALALIIVIFIWKWAGYTFIFLFAGL
QSVPRSLTEAAAMDGSGPIRRAIDIQVPLLAPTLFFLTVIMMTEGFVGADTFGIVASTTE
GGPNHATEVMVYRIVSEAFEGLNYSGASAQSLVLIGLIMVFTFIQFRFVERQVHYK