Protein Info for Atu3090 in Agrobacterium fabrum C58

Annotation: DNA polymerase III subunit epsilon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF00929: RNase_T" amino acids 74 to 228 (155 residues), 57.3 bits, see alignment E=1.5e-19

Best Hits

KEGG orthology group: K02342, DNA polymerase III subunit epsilon [EC: 2.7.7.7] (inferred from 100% identity to atu:Atu3090)

Predicted SEED Role

"Polymerase epsilon subunit"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEN2 at UniProt or InterPro

Protein Sequence (326 amino acids)

>Atu3090 DNA polymerase III subunit epsilon (Agrobacterium fabrum C58)
MTSQMDFFAPAAARLPQAERGRKSGGREAVPKAGTDDEALATHLEATGNYRVLRRLQPRP
VVDRPRPEFPRQGVILDTETTGLDHRTDEIIEIGVITFTFDDQGAIGDVTGIYGGLRQPG
VAIPEDITRLTGITDEMVAGQSIDMMRLTSLIAHADLIIAHNAGFDRPFCEAFSPIFRDK
AWACSVSEIDWRVRGFEGNKLGYLIGQSGYFHDGHRAVDDCFALLEVLEQRRSGQNITPF
AELYEASGRSRVRIYAENSPFDMKDHLKKRGYRWSDGSDGRPKSWWVELPGEKLEEELHF
LRTEIYRWDADPTVKHLTAFDRFRAG