Protein Info for Atu3060 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 transmembrane" amino acids 77 to 98 (22 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 233 to 258 (26 residues), see Phobius details amino acids 320 to 341 (22 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details PF05992: SbmA_BacA" amino acids 85 to 393 (309 residues), 53.9 bits, see alignment E=3e-18 PF06472: ABC_membrane_2" amino acids 86 to 346 (261 residues), 127.1 bits, see alignment E=1.3e-40 PF00005: ABC_tran" amino acids 440 to 574 (135 residues), 73.4 bits, see alignment E=4.4e-24

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 100% identity to atu:Atu3060)

Predicted SEED Role

"putative ABC transporter (fused ATP-binding and permease components)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEL6 at UniProt or InterPro

Protein Sequence (654 amino acids)

>Atu3060 ABC transporter permease (Agrobacterium fabrum C58)
MSDKDAGPKPVVGADETGTQTASQQDAPDTDEPPPPEEMEPASDLTPEQAEEVRRKYLLK
RFWISARGFWSRRGDALAWPFTLGLLVMIGINVGFQYGINIWNRGIFDAIEKRDASTVYF
LASIFPPLVLGSVFIVTSQVYVRMRIQRRWRSWLTKALVGRWIANGRYYQLNLIDGDHQN
PEARLSEDMRIATEAPVDFVSGVIAAFVSASTFIVVLWTIGGALTVSIGGAGVTIPGFLV
IAAVIYAAITSTSIAFIARNFVKVSEVKNQVEAEFRYTLTRVRENGESIALLGGEEEERS
DLDKRFGNVRRQWRLMAQQYMRTTVVSNGSMLIAPVVPLLLCAPKFLDGSMSLGQVMQAA
SAFTIVQSAFGWLVDNYPRLADWNACARRVASLMMSLDGLERAEKSDTVGRIVRGETEGE
TILSLKDVSVSLGDGTAVVKETDVEIGAGERVLVAGESGSGKSTLVRAISGLWPWGGGSV
NFRADSRLFMLPQRPYIPAGTLRRAVCYPQPAESWTSEEIGAALDKVGLGQLKEKIEDEA
PWDQTLSGGEKQRLTFARLLLNAPDIIVMDEATAALDEKSQDKMMQTVIEELPDATIISV
AHRAELEAFHSRKITLERRDGGAKLVSDIELIPRKARAGSMLRRMVKRKNGSKR