Protein Info for Atu3053 in Agrobacterium fabrum C58

Annotation: peptide ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 PF00005: ABC_tran" amino acids 31 to 190 (160 residues), 110.1 bits, see alignment E=7.1e-35 amino acids 308 to 458 (151 residues), 107.3 bits, see alignment E=5e-34 PF08352: oligo_HPY" amino acids 241 to 285 (45 residues), 31.9 bits, see alignment 6.7e-11 amino acids 510 to 537 (28 residues), 26.1 bits, see alignment (E = 4.5e-09)

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to atu:Atu3053)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CRG9 at UniProt or InterPro

Protein Sequence (548 amino acids)

>Atu3053 peptide ABC transporter ATPase (Agrobacterium fabrum C58)
MSHSTTSADVVLSVRNLTVDLPRGMERSHAVKDISFDLHAGEILCIIGESGSGKSVTAST
IMGLLSPVITVSSGEIQFKGMDILAAKEEKIRPLRGQAVSIIFQDPLSALNPLMTVGDQV
AEVLEAHGVGTRETRNAKVLELLEEVGLPDPLLMRLQYPFRLSGGQRQRVMIAMALALDP
DVLIADEPTTALDVTTQAQILELIRKIQKRKNMSVMFITHDFGVVAEIADRVVVMEKGYL
VEQGRADQVLINPVHPYTQRLVAAVPRMRSVERSIDEEVPVVLEVENLEKEYRSSGSFFR
KARTVKAVNNVSFKLRKGQTLGVVGESGSGKSSLGRVLLKLLDPDGGAIRFDGRDIATMD
ESAFRALRPYIQMIFQDPFASLNPRHTIGKILTVGPLAHGMALHEARTKALGILKLVGLD
EQAYDRFPHEFSGGQRQRIGIARALMFDPVVLVADEAVSALDVSIQAQVLELLARVQREM
KVAMIFITHDLRVASQICDDVLVMHKGTVVEQGPPTKIFRAPTHPYTQKLVAAIPGADWE
PSAEVAHM