Protein Info for Atu3023 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 185 to 210 (26 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 76 to 285 (210 residues), 54.6 bits, see alignment E=6.1e-19

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu3023)

Predicted SEED Role

"ABC transporter permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEJ7 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Atu3023 sugar ABC transporter permease (Agrobacterium fabrum C58)
MANFNLYSRGDRIFGWANAILLGLFVLSTLYPFIYVLSVSLSSGAAVTAGRVTLWPVDVT
LAAYDRVLSDRMFWVAYGNTFIYTFGGTLMSLLIMIPGAYALSRKRLRGRTFFNIAIAFT
LWFNAGMIPFFLNMRDLGLLDSRFGIILGFAANAFNVILLRNFFEAVPKSFEEAAKMDGA
SELQLLWKVFIPLSKPAIVTVALFCIVSRWNGYFWAMVLLRGEEKIPLQVYLKRVIVDLN
SNDEFASSLLTAHYSFETVTSAIMIASIIPVLIIYPYAQKYFTKGILLGGVKE